PTM Viewer PTM Viewer

AT1G69120.1

Arabidopsis thaliana [ath]

K-box region and MADS-box transcription factor family protein

No PTMs currently found

PLAZA: AT1G69120
Gene Family: HOM05D000042
Other Names: AGL7,AGAMOUS-like 7,AtAP1; APETALA1; AP1

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 256

MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAMRRNDLELTLEPVYNCNLGCFAA

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002100 1 61
IPR002487 85 178
IPR033896 2 79

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here